.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l4b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Octomeric Two-Subunit TrkA K+ Channel Ring Gating Assembly, TM1088A:TM1088B, from Thermotoga maritima. To be Published
    Site JCSG
    PDB Id 3l4b Target Id 358959
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2711,TM1088A Molecular Weight 16032.54 Da.
    Residues 143 Isoelectric Point 5.12
    Sequence mskkqkskyivifgcgrlgslianlasssghsvvvvdkneyafhrlnsefsgftvvgdaaefetlkecg mekadmvfaftnddstnffismnarymfnvenviarvydpekikifeengikticpavlmiekvkefii gseed
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.45 Rfree 0.30827
    Matthews' coefficent 2.57 Rfactor 0.25893
    Waters Solvent Content 52.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3l4b

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch