.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ksr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative serine hydrolase (NP_639225.1) from XANTHOMONAS CAMPESTRIS at 2.69 A resolution. To be Published
    Site JCSG
    PDB Id 3ksr Target Id 383078
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS7390,NP_639225.1, 88000 Molecular Weight 31599.21 Da.
    Residues 289 Isoelectric Point 6.14
    Sequence meaklssieipvgqdelsgtlltptgmpgvlfvhgwggsqhhslvrareavglgcicmtfdlrghegya smrqsvtraqnlddikaaydqlaslpyvdahsiavvglsyggylsalltrerpvewlalrspalykdah wdqpkvslnadpdlmdyrrralapgdnlalaacaqykgdvllveaendvivphpvmrnyadaftnarsl tsrviagadhalsvkehqqeytralidwltemvvgrrialakevvaarkqllkeqqgdavslpgqgsre frgdiravektsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.69 Rfree 0.222
    Matthews' coefficent 2.78 Rfactor 0.197
    Waters 10 Solvent Content 55.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ksr
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    Gene XCC3885 from Xanthomonas campestris encodes the NP_639225 protein belonging to the prolyl oligopeptidase group (PF00326).

    Pre-SCOP classifies 3ksr in the alpha/beta class, alpha/beta hydrolases superfamily, haloperoxidase family. Dali hits using 3ksr as query, are with 2wtn (Z=23), 1r1d, and 1tqh. Interestingly, 3ksr is similar to 2o2g (Dali Zscr=20), but it contains a novel feature: the first two strands are swapped to form a dimer. The protein is most probably a serine hydrolase based on the conservation of catalytic triad (S108/D186/H217). A PO4 ion in the active site could be relevant to function, i.e. the substrate may contain a phosphate group.

     

    Figure 1. 3ksr dimer formed by strand swapping

    dimer.png

    Figure 2. 3ksr putative active site with the catalytic triad highlighted

    FP4107a-activesite.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     dimer.png
    FP4107A
    147.71 kB22:50, 2 Sep 2009qxuActions
     FP4107a-activesite.png
    FP4107A active site
    211.9 kB20:31, 22 Oct 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch