.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fge

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative flavin reductase with split barrel domain (YP_750721.1) from SHEWANELLA FRIGIDIMARINA NCIMB 400 at 1.74 A resolution. To be published
    Site JCSG
    PDB Id 3fge Target Id 375055
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS6826,YP_750721.1, 2.30.110.10, 93034 Molecular Weight 22645.31 Da.
    Residues 202 Isoelectric Point 5.76
    Sequence mhfskehinaletrtrahfinslsgfksanligtqdrqgntnlsivssvihlganpplmgmiirphsvp rhtfenimqtglytinhvnqsiyeqahqtsarydkdesefeatgltpeylsdfcapfvkesrlkysvkl vehqhlaingtefvigeivdvyvddnavqtdgfidlqaidtvaisgldcyytgdklarlpyakk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.214
    Matthews' coefficent 2.02 Rfactor 0.167
    Waters 147 Solvent Content 39.04

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3fge

    Protein Summary

     YP_750721.1 encodes a protein with 202 residues from SHEWANELLA FRIGIDIMARINA NCIMB 400.  The search results from NCBI sequence alignment suggest that this target carries a conserved FMN binding domain other than hypothetic protein. The sequence belogns to the flavin reductase family (Pfam; PF01613). The SSM structural comparison reveals that this protein that this target should be a structural homolog to 3BPK, 1EJE and 1USC.  The interface interaction suggests that the biomolecule of YP_050331.1 be a dimer.

     

     

    375055_1.png

    Figure 1. Protein YP_750721.1 carries a conserved FMN-Binding domain. Two Ca2+ ions are modeled in the structure.  

     

     

    375055_2.png

     

    Figure 2. The biomolecule of YP_750721.1 should be a dimer based on interface interaction.

     

    375055_3.png

     

    Figure 3. Protein YP_750721.1  (green) is structural homolog to 1EJE(magenta), 1USC(cyan) and 3BPK(purple).

     

      


     

     

    References,

     

    • Christendat, D.,  Yee, A.,  Dharamsi, A.,  Kluger, Y.,  Savchenko, A.,  Cort, J.R.,  Booth, V.,  Mackereth, C.D.,  Saridakis, V.,  Ekiel, I.,  Kozlov, G.,  Maxwell, K.L.,  Wu, N.,  McIntosh, L.P.,  Gehring, K.,  Kennedy, M.A.,  Davidson, A.R.,  Pai, E.F.,  Gerstein, M.,  Edwards, A.M.,  Arrowsmith, C.H.   (2000) Structural proteomics of an archaeon.  Nat.Struct.Biol.   7: 903-909   (PDB 1EJE)

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch