.
The Open Protein Structure Annotation Network
.
TOPSAN > Proteins > JCSG > 3etn

3etn

Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary

Title Crystal structure of putative phosphosugar isomerase involved in capsule formation (YP_209877.1) from Bacteroides fragilis NCTC 9343 at 1.70 A resolution. To be published
Site JCSG
PDB Id 3etn Target Id 391616
Molecular Characteristics
Source Bacteroides fragilis nctc 9343
Alias Ids YP_209877.1 Molecular Weight 21809.05 Da.
Residues 201 Isoelectric Point 5.97
Sequence miesiqellqkeaqavlnipvtdayekaveliveqihrkkgklvtsgmgkagqiamniattfcstgipsv flhpseaqhgdlgilqendllllisnsgktreiveltqlahnlnpglkfivitgnpdsplasesdvcls tghpaevctlgmtpttsttvmtvigdilvvqtmkrteftieeyskrhhggylgeksrklcvk
  BLAST   FFAS   ProFunc   GPSS

Structure Determination
Method XRAY Chains 4
Resolution (Å) 1.70 Rfree 0.197
Matthews' coefficent 2.04 Rfactor 0.172
Waters 728 Solvent Content 39.80

Ligand Information
Ligands CMK (CYTIDINE) x 4;EDO (1,2-ETHANEDIOL) x 9
Metals

Jmol

 

Protein Summary

The sequence of this protein matches SIS domain of PFAM family PF01380 (http://pfam.sanger.ac.uk/family?acc=PF01380). The SIS domain seems to have a common function in phopshosugar isomerization (Bateman 1999). The structure of 391616 matches closely to 1vim (Z=20.7 rmsd 2.7A for 177 Ca with seqid 23%), 1m3s, 1jeo, 2i2w, 1x94, 1viv, 3bjz etc, most of them structural genomics targets.  The biological relevant oligomer is likely tetramer, as observed in the asymmetric unit. This is consistent with the active site arrangement since the C-terminus is required for forming the active site of a neighbour promoter. A CMK (cmp-2-keto-3-deoxy-octulosonic acid) molecule is present in the  active site of 391616, the CMK is idenitified by unambiguous density. The CMK appears to be an inhibitor of 391616 (?). It is similar to Leptospira interrogans polysialic acid capsule expression protein KpsF.

 Figure 1. CMK in experimental density (density modified, 1.5 sigma)

coot.png

 

References

Bateman A; , Trends Biochem Sci 1999;24:94-95.: The SIS domain: a phosphosugar-binding domain. PUBMED:10203754

Teplyakov A, Obmolova G, Badet-Denisot MA, Badet B, Polikarpov I; , Structure 1998;6:1047-1055.: Involvement of the C terminus in intramolecular nitrogen channeling in glucosamine 6-phosphate synthase: evidence from a 1.6 A crystal structure of the isomerase domain. PUBMED:9739095

 

Martinez-Cruz, L.A.,  Dreyer, M.K.,  Boisvert, D.C.,  Yokota, H.,  Martinez-Chantar, M.L.,  Kim, R.,  Kim, S.H. (2002) Crystal structure of MJ1247 protein from M. jannaschii at 2.0 A resolution infers a molecular function of 3-hexulose-6-phosphate isomerase. Structure 10: 195-204

 

Ligand Summary

An CMK (cmp-2-keto-3-deoxy-octulosonic acid) is present in the active site, likely an inhibitor

Reviews

References

 

No references found.

Groups

Tag page

Files (0)

 
You must login to post a comment.

ABOUT SSL CERTIFICATES
All content on this site is licensed under a Creative Commons Attribution 3.0 License
Powered by MindTouch Deki v.8.08.2