| Title | Crystal structure of XisI protein-like (ZP_00106052.1) from Nostoc punctiforme PCC 73102 at 2.30 A resolution. To be published | | Site | JCSG | | PDB Id | 3d7q | Target Id | 368193 | | Molecular Characteristics | | Source | Nostoc punctiforme pcc 73102 | | Alias Ids | NPUN_22DEC03_PLASMIDA_REVISED_GENEPNPAR114 | Molecular Weight | 13168.40 Da. | | Residues | 111 | Isoelectric Point | 5.63 | | Sequence | mdklneyrtkvrqlltkhlqykpsygdveveqifdeehdhyqiisvgwnnqhriygpimhldiknnkiwi qqntteadialelmemgidkqdivigfhtpkmrqlsgfave | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.259 | | Matthews' coefficent | 2.20 | Rfactor | 0.206 | | Waters | 57 | Solvent Content | 43.97 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
368193 is a small protein of 111 residues. The protein belongs to the
XisI family - fdxN element excision controlling factor protein. There are only three structurally close homologs found in PDB (2nlv, 2nvm and 2nwv). No other significant DALI/SSM hits are found with those structures. It is considered that those are the first group of the crystal structures from the XisI-like protein family.
368193 functions as a dimer. Dimer consisits with one monomer (green) and its symmetry mate (pink).
Ligand Summary
References
