.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Domain of Unknown Function with an Immunoglobulin-like Beta-sandwich Fold (YP_001297618.1) from Bacteroides vulgatus ATCC 8482 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3d33 Target Id 390198
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS1784,YP_001297618.1, 88197 Molecular Weight 11787.50 Da.
    Residues 107 Isoelectric Point 4.47
    Sequence anttetpvkdveldgrwddpirsaatncpitvftdgylltlknaspdrdmtiritdmakggvvyendip evqsayitisianfpaeeykleitgtpsghltgyftke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.220
    Matthews' coefficent 2.42 Rfactor 0.174
    Waters 283 Solvent Content 49.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d33
    1. Structure of a membrane-attack complex/perforin (MACPF) family protein from the human gut symbiont Bacteroides thetaiotaomicron
    Q Xu, P Abdubek, T Astakhova, HL Axelrod - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary

    Gene BVU_0276 from Bacteroides vulgatus atcc 8482 encodes the YP_001297618 protein, the first representative with solved structure of the DUF3244 family (PF11589) of ~100 proteins present only in Bacteoides and in the human gut metagenome. DUF3244 family belongs to the Pfam clan of hydroxyisourate hydrolases (HIUase)/transthyretins (TTR). The function of this protein is unknown, and the homologs show extreme sequence divergence with almost no conserved positions across the entire family. The BVU_0276 protein contains a signal peptide with a predicted cleavage site between 28-29. As a result, the crystalized structure (3d33) contains only the 28-134 region of the protein.

    The 3d33 structure belongs to the SCOP immunoglobulin-like beta-sandwich fold and structurally is most similar  to fibronectin (e.g. 1ten rmsd 2.0 for 73 aligned Ca atoms; Dali Z-score=7). DALI top hits are with the glycoside hydrolase family-2 3gm8 (Z=8), tenascin 1qr4 (Z=7), and a fibronectin type III module 1fna (Z=7). A weaker hit is observed with the zebra fish HIUase 2h1x (Z=4.3; 16% seq.id.).

    FFAS shows significant (-12.3) similarity between YP_001297618 and a family of copper resistance proteins CopC (PF04234). This is an unusual, methionine-rich family of copper binding proteins with an immunoglobulin-like fold, represented by the E. coli protein 1ix2 (Dali Z=6). CopC binds copper, but only the apo structure was solved and the molecular details of copper binding are uknown; therefore it is not possible to comment on the conservation of the copper binding site between YP_001297618 and CopC. 3d33 is structurally similar to 1ix2, but the similarity appears to be more distant than that of 3d33 with 1ten (fibronectin).



     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    gs13144a.png
    No description
    69.89 kB22:06, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch