.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cu2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of ribulose-5-phosphate 3-epimerase (YP_718263.1) from Haemophilus somnus 129PT at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 3cu2 Target Id 377798
    Molecular Characteristics
    Source Haemophilus somnus 129pt
    Alias Ids TPS1692,YP_718263.1, 382973 Molecular Weight 26686.61 Da.
    Residues 236 Isoelectric Point 6.21
    Sequence msklsliqqlkqqklsvgilsanwlqlneevttllenqinvlhfdiadgqfsslftvgaigikyfpthc fkdvhlmvrnqlevakavvanganlvtlqleqyhdfaltiewlakqkttyanqvypvligaclcpetpi selepyldqidviqlltldprngtkypselildrviqvekrlgnrrveklinidgsmtlelakyfkqgt hqidwlvsgsalfsgelktnlkvwkssim
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.205
    Matthews' coefficent 2.71 Rfactor 0.166
    Waters 426 Solvent Content 54.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cu2

    Protein Summary

    YP_7182763.1 is a Ribulose-5'-phosphate 3-epimerase base on sequence alignment. The 3D-structural alignment, Dali and SSM search, provides the structural homolog 2FLI to YP_7182763.1.  The conserved active site with Ni has been found in the structure.  The biomolecule of  YP_7182763.1 has been suggested as a dimer according to the SEC data and interface interaction.



    Figure 1 YP_7182763.1 molecule and Ni complex.



    Figure 2 Biomolecule of YP_7182763.1 is a dimer.






    Figure 3 SSM superposing suggets YP_7182763.1 is a
    structural homolog to 2FLI



    Figure 4 The conserved active site in YP_7182763.1 model.


    Ligand Summary

    Ni, Ca

    References

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch