.
The Open Protein Structure Annotation Network
PDB Keyword
.

3csw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a Putative Branched-Chain Amino Acid Aminotransferase (TM0831) from Thermotoga maritima at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 3csw Target Id 282701
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1240,TM0831, _0012.001391_, _0114.000064_, 84893 Molecular Weight 31156.17 Da.
    Residues 273 Isoelectric Point 5.01
    Sequence mliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffnlplslsfdef tkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisnvrripdlstppalkitgrt divlarreivdcydvillglngqvcegsfsnvflvkegklitpsldsgildgitrenviklaksleipv eervvwvwelfeademflthtsagvvpvrrlnehsffeeepgpvtatlmenfepfvlnleenwvgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.200
    Matthews' coefficent 3.98 Rfactor 0.167
    Waters 621 Solvent Content 69.11

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3csw
    1. Structural analysis of mycobacterial branched-chain aminotransferase: implications for inhibitor design
    A Castell, C Mille, T Unge - Acta Crystallographica Section D: , 2010 - scripts.iucr.org
     

    Protein Summary

    TM0831 is a putative BACT (branched-chain amino acid aminotransferase, EC 2.6.1.42). It is involved in biosynthesis of valine and isoleucine by catalyzing the following reaction:

    L-LEUCINE + 2-OXOGLUTARATE = 4-METHYL-2-OXOPENTANOATE + L-GLUTAMATE.

    It shared <=30% sequence identity with several BACTs which has been characterized biochemically and structurally (1i1k/1i1l/1i1m; 1iyd/1iye; 1a3g, 1daa, 1g2w, 1wrv). TM0830 functions as a tetramer, in comparison to trimers or monomers in structural homologs. Additionally, it is interesting to note that the PLPs are only present in the A/C active site, but not in B/D. The residues near PLP are strictly conserved (H47, R50, T228, K133, E164, G190, T192). In TM0831 structure, K133 is not covalently linked to PLP. An interesting obvervation is that the helix equivalent to TM0831 helix 138-147 are likely important functionally in BACT, since it is close to the active site and shows larger variations among homologs.



    Despite relative high sequence similarity, the structure differences are larger than expected.

    Structure comparison table (DaliLite results from server http://www.procksi.net/):

    Z-Scores
    StructuresmonaA-11i1kA-11iydA-11a3gA-11daaA-11g2wA-11wrvA-1
    monaA-148.1 # # # # # #
    1i1kA-131.750.9 # # # # #
    1iydA-132.147.353.5 # # # #
    1a3gA-130.646.545.250.2 # # #
    1daaA-130.034.635.133.447.3 # #
    1g2wA-130.035.035.633.744.647.9 #
    1wrvA-131.041.140.940.033.534.051.5

    Number of Alignments
    StructuresmonaA-11i1kA-11iydA-11a3gA-11daaA-11g2wA-11wrvA-1
    monaA-1274 # # # # # #
    1i1kA-1267298 # # # # #
    1iydA-1272297304 # # # #
    1a3gA-1262295294295 # # #
    1daaA-1258271276267277 # #
    1g2wA-1258270275267277277 #
    1wrvA-1268293293291268268297
    RMSD Values
    StructuresmonaA-11i1kA-11iydA-11a3gA-11daaA-11g2wA-11wrvA-1
    monaA-10.0 # # # # # #
    1i1kA-12.10.0 # # # # #
    1iydA-12.10.40.0 # # # #
    1a3gA-12.00.40.60.0 # # #
    1daaA-12.11.41.61.40.0 # #
    1g2wA-12.11.41.51.40.50.0 #
    1wrvA-12.21.11.21.21.41.40.0

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch