.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cbu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative glutathione S-transferase (YP_295234.1) from Ralstonia eutropha JMP134 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 3cbu Target Id 377866
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS1695,YP_295234.1, 335807 Molecular Weight 23722.21 Da.
    Residues 213 Isoelectric Point 6.62
    Sequence mlklcgfaasnyynkvklalleknvpfeevlawigetdttatpagkvpymitesgslcesevineylea aypqtpllprdpmqagkvreivtflelyleltarelypeaffggkvsdnvkerqlkllsryvpafakla kfspyvagdtftladcaaavhlplvssctkiiygkdlladlpvkeylktlserpsvqkvnadrkantel mlsrnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.207
    Matthews' coefficent 3.38 Rfactor 0.171
    Waters 364 Solvent Content 63.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cbu

    Protein Summary

    Gene Reut_A1011 from Ralstonia eutropha encodes the YP_295234 protein, a probable glutathione S-transferase (GST) showing the N-terminal domain from PF02798 and the C-terminal domain from PF00043. GSTs are enzymes that inactivate toxic compounds by conjugation with glutathione and are involved in resistance towards drugs, antibiotics, insecticides and herbicides.

    pre-SCOP classifies 3cbu N-terminal domain in the alpha/beta class, thioredoxin-like superfamily, GST N-terminal domain family; and the C-terminal domain in the all alpha class, GST C-terminal domain like (super)family. DALI top hits are with GSTs like PDB:3lxz (Z=29), PDB:1v2a (Z=22), PDB:1fw1 (Z=21).

    3cbu structure forms a dimer and contains unmodeled density in the putative active site; however, it is not possible to model glutathione or one of its derivatives in the density.


    Reut_A1011 has 29% seq. id. with the GST-III from the plant Zea mays var. mutin. Like other theta-class GSTs, 3cbu contains a conserved serine residue at position 10, which is proposed to be the main catalytic residue for all theta-class GSTs.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch