.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of FtsZ-like protein of unknown function (ZP_00109722.1) from Nostoc punctiforme PCC 73102 at 1.22 A resolution. To be published
    Site JCSG
    PDB Id 3c8l Target Id 381788
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1759,NPUN_22DEC03_CONTIG1_REVISED_GENENPR1471, BIG_503, 88439 Molecular Weight 13187.58 Da.
    Residues 121 Isoelectric Point 4.93
    Sequence markrliiemgmgidqhgqeptiaasravrnaiahnalpgvwevaglshpnemiievqvavpypeqvre eevlavlpfgrktltvesggmivqgraipelndkndemliaiaavtvliene
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.22 Rfree 0.184
    Matthews' coefficent 2.05 Rfactor 0.158
    Waters 244 Solvent Content 40.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c8l

    Protein Summary

    Npun_R1471 gene from Nostoc punctiforme pcc 73102 encodes the protein YP_001865114 that, according to Pfam, belongs to the Lin0512 family (PF09585).

    The crystal structure (3c8l) reveals that the protein has a four stranded beta-sheet with some helices. There are 2 molecules in the asu forming a dimer. Analysis of crystal packing suggests that the protein may be tetrameric in solution. SEC results are not available yet. The picture below depicts the dimer.

    A DALI search reveals that the top hits  are cell division related FtsZ proteins like 1W5F or 1FSZ (Z-score=6.1) and 1QU9 (Z-score 4.7).

    3c8l structure (magenta, below) is similar to that of the C-terminal portion of FtsZ (this portion of FtsZ has unknown function) which is a bacterial cell division protein. FtsZ (yellow, below) is supposed to have 2 domains, including a GTPase domain (related to p21Ras and EF-Tu).  See Ref. 1.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch