The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative oxidoreductase (ZP_00056571.1) from Magnetospirillum magnetotacticum MS-1 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3c1a Target Id 375584
    Molecular Characteristics
    Source Magnetospirillum magneticum amb-1
    Alias Ids TPS1656,MMAG_12JAN01_CONTIG3880_REVISED_GENE4213, 291437 Molecular Weight 32930.84 Da.
    Residues 314 Isoelectric Point 5.40
    Sequence vsipannspvrlaligagrwgknyirtiaglpgaalvrlassnpdnlalvppgcviesdwrsvvsapev eaviiatppathaeitlaaiasgkavlvekpltldlaeaeavaaaakatgvmvwvehtqlfnpawealk adltsigpilavrseagnhgpyrpggvpmlwdwgahdvsmvldlmgrdpdstsaswaargekdggeagd vtltlafstveahirlcntmdkcrrlavfgeagtlvmddratdkltlhppqpdgnwpvgqghaltvtde mpltravrlfagavrqpepgpsplelglrvvrvlgacs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.256
    Matthews' coefficent 2.69 Rfactor 0.214
    Waters 648 Solvent Content 54.33

    Ligand Information


    Google Scholar output for 3c1a

    Protein Summary

    This protein is a putative oxidoreductase.  Residues 10 - 126 share sequence similarity with the Oxidoreductase family, NAD-binding Rossmann fold (PF01408) with an e-value of 2.3e-34.  This protein has a NAD(P)-binding Rossmann Fold and is especially structurally similar to the Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain family including Bacterial 1,5-Af Reductase (PDB code: 2glx), Oxidoreductase (Tm0312) From Thermotoga Maritima (PDB code: 1zh8), Glucose-Fructose Oxidoreductase From Zymomonas Mobilis (PDB code: 1h6d), Glucose-Fructose Oxidoreductase From Zymomonas Mobilis (PDB code: 1ryd), and a Putative Oxidoreductase (Yp_050235.1) From Erwinia Carotovora Atroseptica Scri1043 (PDB code: 2p2s). This protein is likely a monomer (green - two monomers in asu) although other oxidoreductase (cyan: PDB code: 1zh8) seem to be a dimer.

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    159.8 kB22:04, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch