The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative nitroalkan dioxygenase (TM0800) from Thermotoga maritima at 2.71 A resolution. To be published
    Site JCSG
    PDB Id 3bo9 Target Id 282670
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1234,TM0800, 90090, 85010 Molecular Weight 33671.26 Da.
    Residues 314 Isoelectric Point 5.63
    Sequence mtvrtrvtdlleiehpilmggmawagtptlaaavseagglgiigsgamkpddlrkaiselrqktdkpfg vniilvspwaddlvkvcieekvpvvtfgagnptkyirelkengtkvipvvasdslarmveragadavia egmesgghigevttfvlvnkvsrsvnipviaaggiadgrgmaaafalgaeavqmgtrfvasvesdvhpv ykekivkasirdtvvtgaklghparvlrtpfarkiqemefenpmqaeemlvgslrravvegdlergsfm vgqsaglideikpvkqiiedilkefketveklrgyiee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.71 Rfree 0.211
    Matthews' coefficent 4.63 Rfactor 0.189
    Waters 25 Solvent Content 73.44

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 3bo9

    Protein Summary

    putative nitroalkan dioxygenaseProduct of conserved gene ( FabK of E.coli). Very important participant of Fatty Acid Biosynthesis(FASII). Genome and functional context is perfect:clustering on a chromosome with FabD - Malonyl CoA-acyl carrier protein transacylase (EC, FabZ - (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase (EC 4.2.1.-) (TM0801), FabF - 3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC (TM0802)

    TM0800 is 35% seq identical to 2gjl/2gjn. It is structurally similar to 2gjl/2gjn. The active site residues are conserved, including H146 and the site binding FMN. TM0800 has residual density resemble FMN, but the riboflavin part is highly disordered (thus not modeled).  Thus TM0800 is also likely a deoxygenase.

    Additionally study suggested:

    co-xtallization with FMN
    derive substrate identity from constructed pathway

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch