The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a NTF2-like protein of unknown function (YP_001049020.1) from Shewanella baltica OS155 at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 3blz Target Id 378217
    Molecular Characteristics
    Source Shewanella baltica os155
    Alias Ids TPS1715,YP_001049020.1, 92065 Molecular Weight 13894.93 Da.
    Residues 127 Isoelectric Point 5.72
    Sequence mtnttyvqeyhaivevlskyneggkkadstimrpafssqatifgvdvdnkltggpiqglfdvidnvfhp speakaaiaridivgtaasaridtddisgfrftdffnllkvegkwtvvskiyhthpsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.75 Rfree 0.194
    Matthews' coefficent 2.35 Rfactor 0.152
    Waters 1161 Solvent Content 47.69

    Ligand Information


    Google Scholar output for 3blz

    Protein Summary

    Gene Sbal_0622 from Shewanella baltica os155 encodes the YP_001049020 protein. The function of this protein is unknown.

    The 3blz structure belongs to the alpha+beta class, NTF2-like superfamily from SCOP. According to FFAS, FATCAT, and DALI, 3blz is similar to the NTF2-like protein PDB:3duk (Z=20) and PDB:3fka (Z=18), a ketosteroid isomerase PDB:3d9r (Z=14), a NTF2-like protein of unknown function (PDB:2r4i; Z=14), a domain of unknown function with a cystatin-like fold (PDB:2rgq; Z=13), a calcium/calmodulin-dependent protein kinase (PDB:1hkx; Z=12), and a scytalone dehydratase F162A mutant (PDB code: PDB:1idp; Z=12). 

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch