.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bkx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of cyclopropane-fatty-acyl-phospholipid synthase-like protein (YP_807781.1) from Lactobacillus casei ATCC 334 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3bkx Target Id 379434
    Molecular Characteristics
    Source Lactobacillus casei atcc 334
    Alias Ids TPS1739,YP_807781.1, 86880 Molecular Weight 29664.93 Da.
    Residues 274 Isoelectric Point 5.02
    Sequence mekrldyitdlmalgptanartiqrrqtahrlaiaeawqvkpgekileigcgqgdlsavladqvgssgh vtgidiaspdygapltlgqawnhllagplgdrltvhfntnlsddlgpiadqhfdrvvlahslwyfasan alallfknmaavcdhvdvaewsmqptaldqighlqaamiqgllyaiapsdvanirtlitpdtlaqiahd ntwtytagtivedptlddahweiattnalltelklstdlrdrvkplleamshngtaslatftgritf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.242
    Matthews' coefficent 2.22 Rfactor 0.185
    Waters 493 Solvent Content 44.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bkx

    Protein Summary

    Cyclopropane-fatty-acyl-phospholipid synthase-like protein (YP_807781.1) has strong similarity to SAM-dependent methyltransferases. Cofactor binding (carbonate-ion) residues, such as His129, Trp159, and Glu158 (predicted) are required for methylene transfer activity.

    May be functionally associated with
    fatty-acid desaturase.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch