.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bja

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative MarR-like transcription regulator (NP_978771.1) from Bacillus cereus ATCC 10987 at 2.38 A resolution. To be published
    Site JCSG
    PDB Id 3bja Target Id 376427
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS1678,NP_978771.1, 92696 Molecular Weight 16147.88 Da.
    Residues 138 Isoelectric Point 7.65
    Sequence mnnrelygnirdvyhllqknldkaieqydisyvqfgviqvlaksgkvsmsklienmgcvpsnmttmiqr mkrdgyvmteknpndqretlvyltkkgeetkkqvdvqysdflkencgcftkeeegiledlllkwkkhln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.38 Rfree 0.253
    Matthews' coefficent 2.52 Rfactor 0.233
    Waters 13 Solvent Content 51.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bja

    Protein Summary

    This protein is a putative MarR-like Transcription Regulator.  It shares sequence similarity (FFAS hit to 1lj9, score -51.1) and structural similarity (from DALI, FATCAT, and VAST) to the MarR-like Family including the following structures: the Mexr Repressor Of The Mexab-Oprm Multidrug Efflux Operon Of Pseudomonas Aeruginosa (PDB code: 1lnw), a Putative Dna-Binding Protein (Yp_298295.1) From Ralstonia Eutropha Jmp134 (PDB code: 2obp), an Uncharacterized Protein (Np_147569.1) From Aeropyrum Pernix (PDB code: 2pg4), a Transcriptional Regulator (Tm1171) From Thermotoga Maritima (PDB code: 1o5l), a Transcription Regulator From Bacteroides Thetaiotaomicron Vpi-5482 (PDB code: 1zyb), a Multiple Antibiotic-Resistance Repressor (Marr) (Yp_013417.1) From Listeria Monocytogenes 4b F2365 (PDB code: 2qww), a Transcriptional Regulator, Putative, Mar Family (Tm0816) From Thermotoga Maritima (PDB code: 2eth) and a Transcriptional Regulator (Tm1602) From Thermotoga Maritima (PDB code: 1j5y).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch