.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bhq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of TetR-family transcriptional regulator (NP_105615.1) from Mesorhizobium loti at 1.54 A resolution. To be published
    Site JCSG
    PDB Id 3bhq Target Id 379524
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS1743,NP_105615.1, _0056.000395_, _0052.004968_, 91578 Molecular Weight 23355.59 Da.
    Residues 210 Isoelectric Point 6.85
    Sequence mkidgetrsarkdreiiqaataafiskgydgtsmeeiatkagaskqtvykhftdketlfgevvlstasq vndiiesvttllseaifmegglqqlarrliavlmdeellklrrliianadrmpqlgrawyekgfermla stascfqkltnrgliqtgdpylaashlfgmllwipmneamftgsnrrskaelerhadasveaflavygv qpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.54 Rfree 0.194
    Matthews' coefficent 2.62 Rfactor 0.173
    Waters 436 Solvent Content 52.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bhq

    Protein Summary

    Gene mlr4833 from Mesorhizobium loti encodes the NP_105615 protein, a putative TetR-family transcriptional regulator.  FFAS detects sequence similarity to the TetR_N family (PF00440) from Pfam (FFAS score -26.900) and the Tetracyclin repressor-like, N-terminal domain family from SCOP (FFAS score -36.700). According to DALI, 3bhq is structurally similar to: putative transcriptional repressor (TetrACRR FAMILY) (PDB code: 3c2b, Zscr=18; 1T33, Zscr=16), a Tetr Family Repressor (PDB code: 1T56, Zscr=15), the multidrug binding transcriptional regulator Qacr (PDB code:1jty, Zscr=14), the transcriptional regulator Sco5951 (PDB code:2id3, Zscr=15), and a transcriptional regulator (Rha1_ro04179) (PDB code:2np5, Zscr=11).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch