The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative sulfatase (NP_810509.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 3b5q Target Id 377304
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1685,NP_810509.1, 335720 Molecular Weight 53646.95 Da.
    Residues 481 Isoelectric Point 6.60
    Sequence mglalcgaaaqaqekpnfliiqcdhltqrvvgaygqtqgctlpidevasrgvifsnayvgcplsqpsra alwsgmmphqtnvrsnssepvntrlpenvptlgslfsesgyeavhfgkthdmgslrgfkhkepvakpft dpefpvnndsfldvgtcedavaylsnppkepficiadfqnphnicgfigenagvhtdrpisgplpelpd nfdvedwsniptpvqyiccshrrmtqaahwneenyrhyiaafqhytkmvskqvdsvlkalystpagrnt ivvimadhgdgmashrmvtkhisfydemtnvpfifagpgikqqkkpvdhlltqptldllptlcdlagia vpaekagislaptlrgekqkkshpyvvsewhseyeyvttpgrmvrgprykythylegngeelydmkkdp gerknlakdpkyskilaehrallddyitrskddyrslkvdadprcrnhtpgypshegpgareilkrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.206
    Matthews' coefficent 2.90 Rfactor 0.149
    Waters 363 Solvent Content 57.61

    Ligand Information


    Google Scholar output for 3b5q

    Protein Summary

    The BT_1596 gene from Bacteroides thetaiotaomicron vpi-5482 encodes a putative sulfatase (PF00884, COG3119) that adopts an alkaline phosphatase-like fold and shows significant structural similarity with human aryl sulfatase A (PDB id: 1AUK), an enzyme implicated in a lysosomal storage disorder [Ref], and other human lysosomal sulfatases (PDB id: 1FSU, [Ref]).


    To do: look for any microarray, proteomics etc. data in homologs to further define function; look at conservation of unusually modified aminoacid (formylglycine) - is there any extra density present that might suggest formylation?

    Ligand Summary





    1. (No Results)


      Discuss this publication
    2. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch