.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of CADD-like protein of unknown function (ZP_00108531.1) from Nostoc punctiforme PCC 73102 at 1.35 A resolution (hexagonal form). To be published
    Site JCSG
    PDB Id 3b5o Target Id 377778
    Related PDB Ids 3b5p 
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1691,NPUN_22DEC03_CONTIG1_REVISED_GENENPF6505 Molecular Weight 27098.38 Da.
    Residues 243 Isoelectric Point 4.63
    Sequence mefnhltkqlnqllaqdyvafsitenpvvqmlsqasfaqiayvmqqysifpkelvgftelarrkalgag wngvaqelqenideemgsttggishytlladgleeglgvavkntmpsvatskllrtvlslfdrqvdyvl gatyaieatsipeltlivklvewlhegaipkdlqyffskhldeweieheaglrtsvaayiqpeefgefa agframidamqvwwqelaqeaissevvlstaiaqhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.174
    Matthews' coefficent 2.93 Rfactor 0.155
    Waters 242 Solvent Content 57.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b5o
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The Npun_F6505 gene from Nostoc punctiforme pcc 73102 encodes the NP_001869710 protein of unknown function and adopts a heme oxygenase-like fold. HHPred strongly predicts homology with the TENA/THI-4/PQQC family (PF03070, P-value3.8E-21, residues 22-226), a prediction also supported by structural similarity (PDB id: 1RCW, FATCAT P-value 2.78e-12, DALI Z-score 18.0). The similarity with PDB id 1RCW suggests a role in host cell apoptosis modulation [Ref]

     

    To do: compare 1RCW di-iron center/coordinating residues/death domain interacting surface with Npun_F6505.

    Ligand Summary

     

    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch