.
The Open Protein Structure Annotation Network
.
TOPSAN > Proteins > JCSG > 3fdh
Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary

Site JCSG
PDB Id 3fdh Target Id 393011
Molecular Characteristics
Source Bacteriodes thetaiotaomicron vpi-5482
Alias Ids NP_810946.1 Molecular Weight 54877.63 Da.
Residues 498 Isoelectric Point 4.72
Sequence sedtmdrinkdhdhttsvasrfiladvitstafsnasgdintyassyieyevgvdnqlyyaevrenepss sstfnnswngiysslknariiidqcgeggrdhgndvtrgmaevmaayncaliadffgdapcsqaalvde kgspvymtpkmdtqqeiytqiisylddaianlqkedladvteqdflyagdadkwlkfayglkarytmrl inrssnksadyekvldyvsksftsaddqaafdiydsnninpfygfynsragfgastslgtkllayndpr anrafftpivdkkrsqvaandpslvpapngspdqstskygisafvyaktaptllmsyhelmflkaealc rlnrdaedalkeavvagllnaensisiaikelgsglntnssevitetsagkyfddvvkakyaanplqet miqkylamwgasgeatetyndfrrmkglnenfitltnpnnsskfplrypygnsdtaanpevkaaygngd yvysepvwwaggsr
  BLAST   FFAS   ProFunc   GPSS

Structure Determination
Method Chains
Resolution (Å) Rfree
Matthews' coefficent 2.62 Rfactor
Waters Solvent Content 53.09

Ligand Information
Ligands
Metals

Jmol

 

Protein Summary

Bacteroides thetaiotaomicron  protein BT_2033 (aka JCSG target 393011) is a member of a SusD/RagB family PF07980 of outer membrane nutrient receptors, and is homologous to two other recently solved JCSG structures (3ejn, 3cgh) and to the B. thetaiotamicron SusD (3ck7)). Exact function of BT_2033 is uknown, but it is likely to be involved in nutrient, most likely polysacharides, binding and utilization, as are all others Bacteroides SusD homologs. BT_2033 is likely to form a complex with its genomic neighbor, BT_2032, which is a SusC-homolog. SusC/SusD pairs are always conserved element of polysaccharide utilization loci (PULs) in Bacteroides. BT_2033/BT_2032 pair forms an unusually short PUL, containing only these two proteins.

 

A superposition of these structures are shown below [target (green), 3cgh (cyan), 3ejn (magenta)].

all.png

 

BT_2033 occurs as a monomer in the crystal structure, which is likely different from its biological form where it  probably forms a complex with its genomic neighbor, SusC homolog BT_2032, as do all known SusC/SusD pairs. It should be noted that the first 22 residues at the N-terminus, which form a membrane anchor, were omitted from the construct.

As other SusD homologs, BT_2033 consists of two domains, both helical. An N-terminal half of BT_2033 consists of several TRP-like repeats which support the helical, substrate binding C-terminal domain with a novel fold.

GS13599A.png
 

Ligand Summary

Reviews

References

 

No references found.

Groups

Tag page

Files (0)

 
You must login to post a comment.

ABOUT SSL CERTIFICATES
All content on this site is licensed under a Creative Commons Attribution 3.0 License
Powered by MindTouch Deki v.8.08.2