The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 381938
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS7345,SSUI_28JUL04_CONTIG241_REVISED_GENE1009, BIG_308, 285586 Molecular Weight 60081.38 Da.
    Residues 529 Isoelectric Point 4.87
    Sequence msktiqaitnqiwsmanelrgnmdaseyknyilafmfyrylsehqerflvedeiispapgetvqdayvr eavgndlvehlentashlgyaiepedtwarlvakidnseivasdyqtifdhfnanvelnrdamedfrgv fndinlgdsrlgnstvarakslnsivklidsieykndegkdilgeiyeyligqfaasagkkggefytph qvskilakivtlgleksdtsfsvydptmgsgsllltvrnelpqgqhikfygqemntttynlarmnlmmh qvsysnmilnnadtlesdwpdgvdelgidqprsfdavvanppysakwdnresklkdprfmeygklapas kadfafilhslyhlnntgtmaivlphgvlfrgaaeghirkliieknyldaviglpanlfygtgipttil vfkknrqtkdvffidaskefekgknqnhlsddmvekivetyhnrqsvdkyahlasieeivendynlnip ryvdtfeeeeeidlgqvtqqleqdrleiraledkirqqlktlgvdf
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch