.
The Open Protein Structure Annotation Network
PDB Keyword
.

380225

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 380225
    Molecular Characteristics
    Source Mesorhizobium loti maff303099
    Alias Ids TPS7242,NP_105057.1 Molecular Weight 17050.51 Da.
    Residues 154 Isoelectric Point 5.60
    Sequence pnvlkayafddkklraftdiyndlmlgesglskldremiavavssinhcyycltahgaavrqlsgdpal gemlvmnfraadlsprqtamlefavklteepakiveadraalrkagfsdrdiwdiastaaffnmsnrva aaidmrpndeyhamar
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch