.
The Open Protein Structure Annotation Network
PDB Keyword
.

380206

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 380206
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS7238,YP_297800.1, _0034.004179_, _0011.004359_, _0016.000389_, _0073.006373_, _0003.001719_ Molecular Weight 30205.88 Da.
    Residues 270 Isoelectric Point 5.47
    Sequence mttesppedaqdkyivpglerglrllgefssrertlsaaelarrlkvprstvfrllatlemmgfvertd ggrefrlgmavlrlgfdylasleltelgrplldrlrdeihypcnlvvrdgrsivyvaksvaprpfastv nvgtrlpahatvlgrvlledlsldelralypeshlevfsdstprtveelydmvqrdrergyvlqegffe asistiaapvrdrtgkvvaalgatipasridpdqldnmvemvrgaaaelsrlldyrppepprp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch