The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 380029
    Molecular Characteristics
    Source Streptococcus suis 98hah33
    Alias Ids TPS7233,SSUI_28JUL04_CONTIG268_REVISED_GENE1733 Molecular Weight 44655.46 Da.
    Residues 388 Isoelectric Point 5.47
    Sequence mnylvispfypenfqpftielakkegvtvlgigqepydqlpeelrnalteyfrvedlenidevkraaaf liykhgpidrveshneywlendaalreqfnifgakpkhlkktkfksemkkyfkkagvpvvpgvvvkser dfgralknvgfpmiakpdngvgasgtfkienkedfdrfvetwdgatiyflekfvnssiittydglldhe gnvvfetgltyvhtplelmlsrkdnayfiekeldpqlvkygraiikafgmrerffhieffkdgddyiai eynnrmaggftveaynyahsidlfrdyanvatggtveerrfepqyclvatrrdtteyvhsaddihqkfa gkiktvkrmpdafaelqgndayllvteskkeldemiayigltk
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch