.
The Open Protein Structure Annotation Network
PDB Keyword
.

379267

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 379267
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS7171,DHAF_12NOV03_CONTIG1058_REVISED_GENE1571 Molecular Weight 33399.79 Da.
    Residues 307 Isoelectric Point 5.94
    Sequence mnitivgagatggyfgarlaasglnvtflvrekraaqlrekglviksvvedltleapqiainaedipac dlvllglknyqlaaslpqlkvlvnrgakilpflngvehfeilakelgqenvlggvckiistldsegtih htskvhqiifgelepsgkefclrleqamakanfkvkytenilneiwskyafitvfsgvtsagdlttdqi caheatvkvyrrsleemksladaygaalsedfveqnveglpkyakgstssmhqdmrkgllleveslqga airlagrknmelptietlyglikpyemgsig
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch