.
The Open Protein Structure Annotation Network
PDB Keyword
.

379236

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 379236
    Molecular Characteristics
    Source Desulfovibrio desulfuricans g20
    Alias Ids TPS7165,DDES_06JUN05_CONTIG143_REVISED_GENEDDE1267 Molecular Weight 42419.62 Da.
    Residues 394 Isoelectric Point 5.10
    Sequence vlneqvkksvvdlcaavirqpsvsgeeagvvselkafmessgfdsvtvdrygsiigcvkgnrpgprilf dghidtvpvdaarwtrdpfgaqiengrmygrgtsdmkgavaamavaaaemakpenrdfageiyvagvvh eecfegvaareissavkpdyvvigeasqlnlkiaqrgraeivlqtegkpahsaspdeginavhkmmklv acvealtppeqevlgkgtnaltdiksspypgasvvpsgcrvtydrrllvgetkesilqpirdiiarlqa edsafkatvglaedqapchtgetiraerffpawryeeseefvrqvlgglraagldpqidhyafctngsh yageagirtfgfgpsletlahtddeyieldqlykavagymaisrallqa
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch