The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378779
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS7114,NP_346149.1, _0000.001019_, MCSG_3.40.50.300_ID_777, 103937 Molecular Weight 34257.39 Da.
    Residues 298 Isoelectric Point 5.87
    Sequence mesvgdvlkrqpsrfyyqdlvqkimkdpdvaafiqqesltpkelnrsiskfnqyiterdkflrgdtdyi akgykpilvknhgyadvsyeetpeliaaekeaaiknrlklinlpaslkkaslaqvdlddlgrlpvfekl lafveqypairkglylygdfgvgksfmvaalahdlsekrgvsstllhypsfvidvknaisdgnvktlvd eiklsevlilddigaeqstvwvrdeilqvilqyrmqenlptfftsnfnfedlekhfakvkhgndetwea rrvmerirylaeetrlegvnrr
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch