The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 378737
    Molecular Characteristics
    Source Pediococcus pentosaceus atcc 25745
    Alias Ids TPS7110,PPEN_30JUL02_SCAFFOLD57_REVISED_GENE1501 Molecular Weight 38357.32 Da.
    Residues 338 Isoelectric Point 5.37
    Sequence vedlknltnqavekqpeivkrfnemidsqhlshaylltgaggigkkdvaqwvamrlfcidlqgsmpcge ceectrimsgqhpdvveiapdgqsikveqvrflksefsksgvegarkvfiieqankmttsaansllkfi eepsgevtafllaenrslmlptivsrteiielkplpkdrlikelteqniaetdariltrltndmseiqt lvdnnwildahkalekwfitattgditafvdvqtrvmalakdrfyqekildlmmlyamdllelkfdqet ityeanrrqlqeladqtnvrqllavadvllplkhqlsqnlnfqsvvekatikicnifkmrgr
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch