The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 378730
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS7109,DHAF_12NOV03_CONTIG1086_REVISED_GENE3509 Molecular Weight 38169.75 Da.
    Residues 340 Isoelectric Point 6.47
    Sequence malkkiclenftvfdkmeiefcdgvnvligengtgkthimkllyaacqsahaskkvisfpqkivqvfkp dhanisrllsrkagngsakvhvisgnntlktsfnlktknwdaevvgaqawekqlsnltstfipakeils nsknlvnainvgnvdfddtykdiisvasvdinrgpnnvqkekylqilqditdgkvsyeneefyllpgnq aklefqlvaegmrkiallwqlikngtleqgtvlfwdepeaninpkhipalvevllnlqgdgvqifiath dyvlakyleirmadankirfhslykkegrvevesnhnfkdlvnnsiaeaynklldevfeqttkg
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch