The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378395
    Molecular Characteristics
    Source Saccharopolyspora erythraea nrrl 2338
    Alias Ids TPS7094,YP_001108201.1, PF04672, 291281 Molecular Weight 29871.30 Da.
    Residues 266 Isoelectric Point 5.31
    Sequence mpeqnsfppevdhtrpnpariydyglgghhnfaadrdqfekllevdpdarlvvsanraflrravryclr qgitqfldlgsgiptvgnvheaahqlnprarvvyvdnepiavahtrrllrenenaeivqadlrdpdail gapetqrlldlskpvglmmvavlhwvpsadvagllsryrevlapgsylaishltsehlpeqmgevedvf aettepvvyrprseavklfegfelvppgvvytsqwqsepyemveppertkiwaavgrkl
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch