The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 378208
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS7058,YP_324686.1, 3.10.450.50, 92743 Molecular Weight 14647.85 Da.
    Residues 129 Isoelectric Point 4.64
    Sequence mklhdqdqirrifeevypdnvragdlsayadmytedalwmppngldrcgipdilegfadtiadkdidpi ftaeeievkgdsgyvigislaticpkdgspstqvkyralwlmkkdgdrwkiarqiwnvkp
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch