The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 359535
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS2752,NP_249499.1, 85210 Molecular Weight 17550.14 Da.
    Residues 157 Isoelectric Point 5.10
    Sequence mnavaqvvakaemlirrpiaevfeafvdpaitarfwfsrgdarleagkrlrwhwdmygvsqeievkdlq tnrriliewpngdsnpsqvewlfeelpgagtfvsirnsgfvgtpeeviprvvdategftlvlaglkacl ehgialnlvadrfprgldg
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch