.
The Open Protein Structure Annotation Network
PDB Keyword
.

358791

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 358791
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS2702,2649030, 282966 Molecular Weight 13153.44 Da.
    Residues 116 Isoelectric Point 4.93
    Sequence mseakelikkmcdlqnsneeiqkemagwsgvvqykldgeefyveyksdgtcefkegvhssptftvvapp dfwlavlkgqedpvsgfmmgkyriegnimeaqrlagvikkfqgkfel
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary

    The putative sterol carrier protein 2 (NP_070363) is encoded in the genomic neighborhood of a predicted membrane protein (NP_070362).


    Structural similarity:
    PDBid	Chain	Z-Score	Aligned	RMSD[Å]	Seq. Identity [%]
    1ikt A 11.5 93 2.3 19
    2cg3 A 11.1 91 2.4 15 <-similarity to the C-terminal domain of 2cg3 only.
    1pz4 A 10.8 87 2.2 13
    1c44 A 10.7 96 2.2 19
    1wfr A 8.4 96 2.6 22

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch