.
The Open Protein Structure Annotation Network
PDB Keyword
.

358493

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 358493
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2689,TM1840 Molecular Weight 61929.85 Da.
    Residues 529 Isoelectric Point 4.66
    Sequence sqslvssnphsnstntdgtssnleevkypvvyeifirsfydrdgngvgdlngvsqkvdylkelgvdavw fmpfneavsyhgyditdyynvekdygtmedlenmiqvlhengikvimdlvinhtsdehpwfkdaventt sspywdyyimsledhsgqdhwhwkinskgqkvwyfglfgynmpdlnhdsqkvreevkkivdfwiskgvd gfridaakhiygwswddgiqesaeyfewfrdyvlskkpdailvgevfsgntydlslypipvfnfalmys irnypegqdgmiennwveesflflenhdlhrffshlqehykkfsesdyefikkraalwyfliftlkgsp viyyggeigtrgfkwhgpvydepvrepmqwyasgtgegqtfwtkevyknagitfgnadvdgciyddpyd gfsveeqesdpksllnfirfilnfrkdhdailngdqtifrdwknliafyressnekllvvlnpdpvwqn sftfeenmtmilevdfenfiwnesnvsfsagesftvdpmkayifkk
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1840
    generated 12/2008
    Transmembrane protein

    HMM_TM1840

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch