.
The Open Protein Structure Annotation Network
PDB Keyword
.

357352

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357352
    Molecular Characteristics
    Source Haemophilus influenzae rd kw20
    Alias Ids TPS2530,1573135 Molecular Weight 28233.91 Da.
    Residues 246 Isoelectric Point 5.69
    Sequence msvlgrihsfescgtvdgpgirfilfmqgclmrckychnrdtwdleggkeisvedlmkevvtyrhfmna tgggvtasggeavlqaefvrdwfrackeegintcldtngfvrhydhiidelldvtdlvlldlkelndqv hqnligvpnkrtlefakylqkrnqhtwiryvvvpgytdsdhdvhllgqfiegmtniekvellpyhrlgv hkwktlgldyelenvlpptkeslehiktilegyghtvkf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch