The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 357273
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS2526,EF2554, 282570, 282617 Molecular Weight 40245.18 Da.
    Residues 357 Isoelectric Point 4.84
    Sequence mydqlqsiedryeelgellsdpavisdtkrfmelskeeantretvevyrrykqvvegisdaeellsenl daemaemakeelsdlkkekevledrikilllpkdpnddkniimeirgaaggdeaalfagdlfnmyqkya eaqgwkaevleanvtgiggykevimmisgdnvfsklkyesgahrvqrvpstesqgrihtstatvvvmpe aeeveieladkdirvdiyhasgaggqhvnktasavrlthlptgivvamqdersqlknrekamkvlrarv ydqiqqeaqseydanrksavgtgdrserirtynfpqnrvtdhrigltiqkldqilagkldeiidalvly dqtskleemqng
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch