.
The Open Protein Structure Annotation Network
PDB Keyword
.

357219

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357219
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS2520,6459023 Molecular Weight 10650.50 Da.
    Residues 96 Isoelectric Point 4.65
    Sequence midaaqidhltalarlelspaerrtmqqdltrmlgyfeqlgrvptegvqemqrpvslvnvlrddapget fpsgvvsalapetqdgfirvprtvdte
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch