.
The Open Protein Structure Annotation Network
PDB Keyword
.

354950

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 354950
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS2428,YDL236W Molecular Weight 34622.72 Da.
    Residues 312 Isoelectric Point 6.00
    Sequence mtaqqgvpikitnkeiaqefldkydtflfdcdgvlwlgsqalpytleilnllkqlgkqlifvtnnstks rlaytkkfasfgidvkeeqiftsgyasavyirdflklqpgkdkvwvfgesgigeelklmgyeslggads rldtpfdaakspflvngldkdvscviagldtkvnyhrlavtlqylqkdsvhfvgtnvdstfpqkgytfp gagsmieslafssnrrpsycgkpnqnmlnsiisafnldrskccmvgdrlntdmkfgvegglggtllvls gieteeralkishdyprpkfyidklgdiytltnnel
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch