.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rbd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a domain with unknown function and a ferritin-like fold (NP_243224.1) from Bacillus halodurans at 1.54 A resolution. To be published
    Site JCSG
    PDB Id 2rbd Target Id 378013
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1704,NP_243224.1, 335681 Molecular Weight 18834.37 Da.
    Residues 170 Isoelectric Point 5.18
    Sequence mgilsgnpqdeplhygevfstwtylstnnglingyrsfinhtgdedlknlideaiqamqdenhqleell rsngvglppappdrpaarlddipvgarfndpeisatismdvakglvtcsqiigqsiredvalmfsqfhm akvqfggkmlklnknkgwlippplhsdrpike
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.54 Rfree 0.188
    Matthews' coefficent 2.46 Rfactor 0.159
    Waters 439 Solvent Content 49.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rbd

    Protein Summary

    The BH2358 gene from Baccilus halodurans encodes a protein that according to FFAS belongs to PF07875: Coat F domain (FFAS score: -13.900) and COG5577: Spore coat protein (FFAS score: -29.200). The structure is a four helix bundle and has a ferritin-like fold. However, it also has structural similarity and weak, non-significant sequence similarity to the Dps family.  There are several Dps family members and homologs in PDB.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch