The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of pyruvate oxidoreductase subunit PORC (EC (TM0015) from Thermotoga maritima at 2.12 A resolution. To be published
    Site JCSG
    PDB Id 2raa Target Id 281896
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1177,TM0015, 83933 Molecular Weight 21268.52 Da.
    Residues 192 Isoelectric Point 8.47
    Sequence mpvakkyfeirwhgragqgaksasqmlaeaaleagkyvqafpeygaertgapmrafnrigdeyirvrsa venpdvvvvidetllspaiveglsedgillvntvkdfefvrkktgfngkicvvdatdialqeikrgipn tpmlgalvrvtgivpleaiekriekmfgkkfpqevidankralrrgyeevkcse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.12 Rfree 0.251
    Matthews' coefficent 2.62 Rfactor 0.215
    Waters 27 Solvent Content 52.99

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 2raa
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier

    Protein Summary

    This structure is gamma subunit of pyruvate synthase. It is homologous
    to 3rd domain (416-627) of 1b0p (<18%seq id). This structure is 2nd
    structural candidate of ProC domain.

    Based on analysis of sequence conservation: the following residues are
    likely important, they are: 17-GQGA-20, 41-FPEY-44 etc. In 1b0p, these
    corresponding residues interact with 1195-1121 region (domain VII).
    This suggests that the assembly of the gamma unit may resemble what is
    seen in single-chain 1b0p. If this is the case, the loop around 48
    would be close to one of the Fe-S4 cluster. Another region 62-69,
    disorder in this structure, is also likely to be involved in binding of
    using 1b0p as a guide. Additionally, this domain may be involved in the
    channel forming per 1b0p paper.

    Thermotoga has 4 types of subunits (PorA=TM0017, PorB=TM0018,
    PorC/PorG=TM0015 and PorD=TM0016), how these subunits assembly together
    is interesting. It would be interesting to model the POR complex since
    all the subunits has at least one homologous structures in the PDB.
    Ultimately, it is good to crystalize the 4 subunits together.

    Ligand Summary

    There is no active site since it is a structural protein. It may have a conserved surface to bind other protein in the big complex.





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch