The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative D-alanine N-acetyltransferase of GNAT family (YP_389533.1) from Desulfovibrio desulfuricans G20 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2r7h Target Id 376338
    Molecular Characteristics
    Source Desulfovibrio desulfuricans g20
    Alias Ids TPS1673,YP_389533.1, 103631 Molecular Weight 19348.83 Da.
    Residues 176 Isoelectric Point 5.66
    Sequence mpqtlkpdtpagtpaagavafrrqvlpqdallvrrvvestgfftpeeadvaqelvdehlmhgaacgyhf vfatedddmagyacygptpategtydlywiavaphrqhsglgrallaevvhdvrltggrllfaetsgir kyaptrrfyeragfsaeavlkafyragddkiiyrleva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.246
    Matthews' coefficent 2.33 Rfactor 0.209
    Waters 128 Solvent Content 47.17

    Ligand Information


    Google Scholar output for 2r7h

    Protein Summary

    Gene Dde_3044 encodes the YP_389533.1 sequence that belongs to the GCN5-related N-acetyltransferase (GNAT) group (PF00583). Analysis of its genome context indicates the presence in its vicinity of a D-Ala, D-Ala ligase (YP_389531), with a 0.869 score.


    2r7h structure classifies in the SCOP alpha+beta class, Acyl-CoA N-acyltransferase superfamily, N-acetyl transferase family. Structural similarity analysis provides the most reliable hits (FFAS scr=-50; HHpred P-val=1e-30; Dali Z-scr=19; FATCAT P-val=1e-11) with 1ghe, a tabtoxin resistance protein [Ref], and 2cnm, a ribosomal protein acetyl transferase [Ref].   

    Ligand Summary





    1. (No Results)


      Discuss this publication
    2. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch