The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative kinase in the ribokinase-like superfamily from Enterococcus faecalis V583 (NP_815490.1) at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 2r3e Target Id 375213
    Related PDB Ids 2r3b 
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS1929,NP_815490.1, 3.40.1190.20, 285318 Molecular Weight 31721.70 Da.
    Residues 291 Isoelectric Point 6.75
    Sequence mrylskdileevitqrpsdsyksnfgrvvliggnrqyggaiimsteacinsgaglttvitdvknhgplh arcpeamvvgfeetvlltnvveqadviligpglgldataqqilkmvlaqhqkqqwliidgsaitlfsqg nfsltypekvvftphqmewqrlshlpieqqtlannqrqqaklgstivlkshrttifhagepfqntggnp gmatggtgdtlagiiagflaqfkptietiagavylhsligddlaktdyvvlptkisqalptymkkyaqp htapdselleqkrsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.194
    Matthews' coefficent 2.37 Rfactor 0.155
    Waters 142 Solvent Content 48.21

    Ligand Information


    Google Scholar output for 2r3e

    Protein Summary

    The EF1790 gene (PF01256 (also related to PF02110 and PF00294), cd01171, cl00192) from Enterococcus faecalis V583 encodes the NP_815490, a putative carbohydrate kinase (EC:2.7.-.-).

    The protein structure, 2r3e, adopts a 3 layer alpha/beta/alpha sandwich, inside the alpha/beta class, ribokinase-like superfamily, YjeF C-terminal domain-like family (cf. SCOP and CATH). According to DALI structural similarity to 2r3e is presented by the uncharacterized protein 3bgk (Z=42), the TM0922 protein 2ax3 (256 equivalent residues, 1.8A rmsd, 27% sequence identity, Z=35), the carbohydrate kinase 3k5w (Z=28) and the thiazole kinase 1v8a (Z=21).

    2r3e predicted functional biomolecule is a tetramer. HHpred ranks as top hit carbohydrate kinases, further strengthening this annotation. There are various PSI-determined protein structures with similar fold, eg.  3k5w, 3dzv, 2qcv, and 2qhp.

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    30.43 kB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch