.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qg3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of uncharacterized protein AF2059 (2648472) from Archaeoglobus fulgidus at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 2qg3 Target Id 355678
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS1348,2648472 Molecular Weight 22078.30 Da.
    Residues 196 Isoelectric Point 6.21
    Sequence mmweqfkkeklrgyleaknqrkvdfdivelldlinsfddfvtlsscsgriavvdlekpgdkasslflgk whegvevsevaeaalrsrkvawliqyppiihvacrnigaakllmnaantagfrrsgvislsnyvveias lerielpvaekglmlvddaylsyvvrwanekllkgkeklgrlqealeslqrenaycsd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.253
    Matthews' coefficent 2.02 Rfactor 0.199
    Waters 82 Solvent Content 39.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qg3
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The AF_2059 gene (PF02676, cl00689) from Archaeoglobus fulgidus DSM 4304 encodes the protein NP_070883 from the methyltransferase TYW3 family. The methyltransferase TYW3 has been found to be involved in wybutosine (yW) biosynthesis in eukaryotes like plants [Ref] and yeast [Ref]. Wybutosine is a largely modified guanosine residue found in the anticodon region of eukaryotic Phe-tRNA. Sequence homologs have also been found in archaea but not in bacteria.

    The 2qg3 structure belongs to the SCOP alpha+beta class, SSo0622-like (super)family. Dali identifies a PSI determined structure, 1tlj (Zscr=22) as significantly similar to 2qg3. Two other structures sharing more than 30% sequence identity have been determined outside PSI centers: 2drv (Z=25) and 2it2 (Z=24) from Pyrococcus hirokoshii.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch