.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q78

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Uncharacterized protein TM0581 (TM0581) from Thermotoga maritima at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 2q78 Target Id 282454
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1218,TM0581, 90083, 289464 Molecular Weight 15866.72 Da.
    Residues 141 Isoelectric Point 6.31
    Sequence mmdfdflegkrltedvaldetmvwnediemldlhlvatsaligvvhrvsyellsrylpndytavvvetl arhvkavptgtrvavgvrvvgvvgnrvkfrgivmsgdekileaefvraivpreklrrlalekaektsrl fgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.20 Rfree 0.224
    Matthews' coefficent 2.23 Rfactor 0.175
    Waters 282 Solvent Content 44.96

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q78
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    3. Dveloppement d'une nouvelle mthode performante de classification des surfaces protiques d'interaction. Optimisations et extensions du logiciel MED-SuMo.
    O Doppelt-Azeroual - 2009 - hal-univ-diderot.archives-ouvertes.fr
     

    Protein Summary

    Gene TM0581 fromThermotoga maritima encodes the NP_228391 protein with a classic so-called "hot-dog" thioesterase fold that binds malonyl-CoA (MCL). According to the STRING database (http://string.embl.de/), by genomic neighbourhood analysis, TM0581 is functionally associated with the following proteins:

    TM0580 Cell division protein FtsH (610 aa)
    TM0582 Fe-S oxidoreductase radical SAM domain protein  (UniProtKB /TrEMBL-Q9WZ51} (486 aa)
    TM0583 Lipopolysaccharide biosynthesis protein (434 aa)
    tilS (TM0579) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytid

    TM0581 is likely to function as a regulator in lipid biosynthesis.

    SCOP classifies 2q78 in the alpha+beta class, thioesterase superfamily, TTHA0967-like family. DALI top hits are with thioesterase PDB:2cwz (Z=16) PDB:3gek (Z=14) and PDB:1s5u (Z=13). Compared to PDB:2f3x (Z=12), 2q78 also bind MCL; however, this structure is the first structure with full MCL identified unambiguously. The MCL molecules are in similar location in 2f3x and 2q78 but there are significant differences in specific contacts.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch