.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q14

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Phosphohydrolase (BT4208) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 2q14 Target Id 356887
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1370,BT4208, BIG_206, 289763, 289422, 89901 Molecular Weight 46944.39 Da.
    Residues 409 Isoelectric Point 5.88
    Sequence mpyerkiindpvfgfinipkgllydivrhpllqrltrikqvglssvvypgaqhtrfqhslgafylmsea itqltskgnfifdseaeavqaaillhdighgpfshvledtivqgvsheeislmlmermnkemngqlsla iqifkdeypkrflhqlvsgqldmdrldylrrdsfytgvtegnigsariikmldvaddrlvieskgiysi enfltarrlmywqvylhktsvayermlistllrakelasqgvelfaspalhfflyndinhtefhnnpdc lenfiqlddndiwtalkvwsnhpdkvlstlslgminrnifkvensaepigedrikeltlqisqqlgitl seanyfvstpsieknmydpaddsidiiykdgtikniaeasdmlnisllskkvkkyylcyqrlhr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.20 Rfree 0.252
    Matthews' coefficent 2.90 Rfactor 0.207
    Waters 1624 Solvent Content 57.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q14
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Modelling the structure of the red cell membrane
    NM Burton, LJ Bruce - Biochemistry and Cell Biology, 2011 - ingentaconnect.com
     
    3. Identification and computationally_based structural interpretation of naturally occurring variants of human protein C
    E Rovida, G Merati, P D'Ursi, S Zanardelli - Human , 2007 - Wiley Online Library
     
    4. Biochemical Properties of Indoleamine 2, 3-dioxygenase: From Structure to Optimized Design of Inhibitors
    S Lancellotti, L Novarese - Current Medicinal , 2011 - ingentaconnect.com
     
    5. An Overview of the proacrosin/acrosin system in human spermatozoa
    MH Vazquez-Levin, LI Furlong, CM Veaute - Treballs de la Societat , 2007 - revistes.iec.cat
     
    6. Characterization of the Deoxynucleotide Triphosphate Triphosphohydrolase (dNTPase) Activity of the EF1143 Protein from Enterococcus faecalis and Crystal
    II Vorontsov, G Minasov, O Kiryukhina - Journal of Biological , 2011 - ASBMB
     
    7. Annotation of hypothetical proteins orthologous in Pongo abelii and Sus scrofa
    S Jitendra, R Narula, S Agnihotri, M Singh - Bioinformation, 2011 - ncbi.nlm.nih.gov
     
    8. Dipeptidyl Peptidases: Substrates and Therapeutic Targeting in Human Health and Disease
    CH Wilson, CA Abbott - 2011 - pubs.rsc.org
     
    9. Neutral sphingomyelinase-3 and its use
    M Krnke, U Hoppe - EP Patent , 2011 - freepatentsonline.com
     
    10. Study on herb-drug interactions
    L Yang - 2009 - researchbank.rmit.edu.au
     

    Protein Summary

    The BT_4208 gene from  Bacteroides thetaiotaomicron VPI-5482 encodes for a metal dependent phosphohydrolase (PF01966, cl00076) found in bacteria, archaea and eukaryotes. The protein adopts a mainly alpha helical fold. The functional biomolecule is a tetramer, according to both the author and PISA software. The octamer asymmetric unit holds two biomolecules. According to CATH, each chain is composed of two domains (2q14-CATH). Protein structures with very high structural similarity and sequence identity >30% include the PSI determined 2ogi and 2hek [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch