.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pq7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of predicted HD superfamily hydrolase (104161995) from uncultured Thermotogales bacterium at 1.45 A resolution. To be published
    Site JCSG
    PDB Id 2pq7 Target Id 371986
    Molecular Characteristics
    Source Uncultured thermotogales bacterium
    Alias Ids TPS1599,104161995, BIG_195, _0030.001733_, 92977 Molecular Weight 24633.54 Da.
    Residues 219 Isoelectric Point 6.36
    Sequence mnltelmeriphlreilnivreafkdyddpahdishtfrvmenaseiasrekcdlqkaiiaallhdikr phealtgvdhaesgaeyasgllptmgfdisfvaevskairshrysggltptsltgkilqdadrldaiga vaiarvfsysgktgtplhslqfsprssysgnsrssinhfhekilkirpetfwtetarkmaedrysfvve fvqrflaewgqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.193
    Matthews' coefficent 2.12 Rfactor 0.183
    Waters 148 Solvent Content 42.03

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pq7
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Structural and Biochemical Analysis of Nuclease Domain of Clustered Regularly Interspaced Short Palindromic Repeat (CRISPR)-associated Protein 3 (Cas3)
    S Mulepati, S Bailey - Journal of Biological Chemistry, 2011 - ASBMB
     
    3. An Fe2+-Dependent Cyclic Phosphodiesterase Catalyzes the Hydrolysis of 7, 8-Dihydro-d-neopterin 2_, 3_-Cyclic Phosphate in Methanopterin Biosynthesis
    Z Mashhadi, H Xu, RH White - Biochemistry, 2009 - ACS Publications
     
    4. Structure and activity of the Cas3 HD nuclease MJ0384, an effector enzyme of the CRISPR interference
    N Beloglazova, P Petit, R Flick, G Brown - The EMBO , 2011 - nature.com
     
    5. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     
    6. Identification and Characterization of the Enzymes Involved in Biosynthesis of FAD and Tetrahydromethanopterin in Methanocaldococcus jannaschii
    Z Mashhadi - 2010 - scholar.lib.vt.edu
     

    Protein Summary

    The mes0020 gene translates into the CAJ75704.1 protein sequence that belongs to the HD domain family (PF01966), characterized by the conservation of several His and Asp amino acids involved in the coordination of divalent cations. The positions here are: H36-H65-D66-H79-H111-D131. The refined structural coordinates include 2 PO4 ions and 2 Fe metals chelated by the side chains of the aforementioned residues. YP_002940461, a metal dependent phosphohydrolase, bears 50% sequence identity with CAJ75704.

     

    SCOP classfies 2pq7 in the all alpha class, HD-domain/PDEase-like superfamily, HD domain family. High structural similarity (FFAS scr=-70~-67; SSM 89%-67%; Dali Z-scr=17.2-15.0; FATCAT P-val=1e-9~6e-7) is presented with 2pjq, 2qgs and 3b57, all putative hydrolases.

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch