.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p7i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (YP_049838.1) from Erwinia carotovora atroseptica SCRI1043 at 1.74 A resolution. To be published
    Site JCSG
    PDB Id 2p7i Target Id 371321
    Related PDB Ids 2p7h 
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1927,YP_049838.1, BIG_554, 283396 Molecular Weight 28405.56 Da.
    Residues 249 Isoelectric Point 5.53
    Sequence mtisrnydqeikdtaghkyaynfdfdvmhpfmvraftpffrpgnllelgsfkgdftsrlqehfnditcv easeeaishaqgrlkdgityihsrfedaqlprrydnivlthvlehiddpvallkrinddwlaeggrlfl vcpnanavsrqiavkmgiishnsavteaefahghrctyaldtlerdasraglqvtyrsgiffkalanfq wdqilqtdilskeyldgcyqlgqqypdlcasifllcekginq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.74 Rfree 0.18
    Matthews' coefficent 2.38 Rfactor 0.155
    Waters 375 Solvent Content 48.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p7i
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    2p7i structure has identical sequence but different crystal form compared to 2p7h. See 2p7h entry for functional information. 

    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2p7h.png
    No description
    46.18 kB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch