.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p4o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (ZP_00111901.1) from Nostoc punctiforme PCC 73102 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2p4o Target Id 369877
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1552,NPUN_22DEC03_CONTIG1_REVISED_GENENPF0524, 103915 Molecular Weight 32347.75 Da.
    Residues 305 Isoelectric Point 4.35
    Sequence mgdsaglppiyadkpielapakiitsfpvntflenlasapdgtifvtnhevgeivsitpdgnqqihatv egkvsglaftsngdlvatgwnadsipvvslvksdgtvetlltlpdaiflngitplsdtqyltadsyrga iwlidvvqpsgsiwlehpmlarsnsesvfpaanglkrfgnflyvsntekmlllripvdstdkpgepeif veqtniddfafdvegnlygathiynsvvriapdrsttiiaqaeqgvigstavafgqtegdctaiyvvtn ggmflppptgvvpanvvrlevgkpgyplg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 2.41 Rfactor 0.172
    Waters 134 Solvent Content 48.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p4o

    Protein Summary

    The Npun_F0524 gene encodes the amino acid sequence YP_001864238.1 (obsolete entry ZP_00111901.1) which is a hypothetical protein with a weak hit (e-value=5.8e-5) with the SMP-30/Gluconolactonase/LRE-like region (SGL) family PFAM:PF08450. STRING analysis of its genome context finds with a 0.849 score the NADPH-dependent carboxyl reductase NP_484396 (GI:17227848). 

    SCOP classifies 2p4o in the all-beta class, calcium-dependent phosphotriesterase superfamily, All0351-like family. Structural similarity analysis provides the lactonase Drp35 PDB:2DG0(apo) PDB:2DG1 (Ca-bound) as the strongest hit (FFAS score=-48; HHpred P-val=1e-37; SSM 84%; Dali Z-scr=31.0; FATCAT P-val=2.5e-13, 34% identity). This enzyme belongs to the SGL family [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch