.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Cupin 2, conserved barrel (EAT53321.1) from Desulfitobacterium hafniense DCB-2 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2ozj Target Id 366882
    Molecular Characteristics
    Source Desulfitobacterium hafniense y51
    Alias Ids TPS1486,YP_518966.1, 2.60.120.10, 90889 Molecular Weight 12726.94 Da.
    Residues 113 Isoelectric Point 4.63
    Sequence marlknlpqerplplasliearenqvlsmalaqsdrvqislfsfadgesvseeeyfgdtlylilqgeav itfddqkidlvpedvlmvpahkihaiagkgrfkmlqitlideer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.21269
    Matthews' coefficent 2.07 Rfactor 0.1822
    Waters 136 Solvent Content 40.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ozj
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete chrysosporium with the Reaction Intermediate Ascopyrone M
    M Claesson, Y Lindqvist, S Madrid, T Sandalova - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary

    The DSY2733 gene translates into the YP_518966.1 amino acid sequence which corresponds to a 113 residues long protein belonging to the Cupin-2 family, characterized by a ~70 aa sequence containing the conserved  motifs PGxxxxxHxH, and HxxxN, weakly present here (PF07883). Analysis of the gene context detects with a 0.785 score the putative translocase protein YP_518968.

     

    SCOP classifies 2ozj inside the all-beta class, superfamily RmlC-like cupins, family TM1287-like. FFAS (score -52) and HHpred (P-val=1.7e-39) provide a top hit with 1yhf; Dali (Z-scr=17) and FATCAT (P-val=1.5e-14) corroborate finding. A close second hit is 3fjs. SSM finds high secondary structure matching (63%) with 2f4p, a cupin-like protein. 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch