.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_638301.1) from Xanthomonas campestris at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 2ozh Target Id 371737
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS1593,NP_638301.1, 91816 Molecular Weight 15711.06 Da.
    Residues 141 Isoelectric Point 6.35
    Sequence mphvhvstdnslldiglihrtlsqdtdwakdiplalvqraidhslcfggfvdgrqvafarvisdyatfa ylgdvfvlpehrgrgyskalmdavmahpdlqglrrfslatsdahglyarygftpplfpqslmeryvpgl yst
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.155
    Matthews' coefficent 2.76 Rfactor 0.143
    Waters 249 Solvent Content 55.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ozh

    Protein Summary

    Gene XCC2953 (PF00583, cl00443) from Xanthomonas campestris encodes a putative acetyltransferase from the GNAT family. Its genomic neighborhood includes a link (score 0.65) with the acetylornithine deacetylase argE.

    Pre-SCOP classifies 2ozh in the alpha+beta class, Acyl-CoA N-acyltransferases superfamily, NAT family. Top DALI hits for 2ozh are with the SA2161 protein 1y7r (Z=14), the YPEA protein 2pdo (Z=13), and the putative acetylglutamate synthetase 2r98 (Z=13).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch