The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (JCVI_PEP_1096672785533) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 2op5 Target Id 367476
    Molecular Characteristics
    Alias Ids TPS1512,JCVI_PEP_1096672785533, 430154 Molecular Weight 13717.99 Da.
    Residues 116 Isoelectric Point 5.64
    Sequence mkdtdetaflnslfmdftsenelelflksldevwsedlysrlsaaglirhviskvwnkeqhrismvfey dskegyqkcqeiidkefgitlkeklkkfvfkihnnrgvvvsefirst
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.292
    Matthews' coefficent 2.07 Rfactor 0.23
    Waters 161 Solvent Content 40.70

    Ligand Information


    Google Scholar output for 2op5
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. Probing metagenomics by rapid cluster analysis of very large datasets
    W Li, JC Wooley, A Godzik - PLoS One, 2008 - dx.plos.org
    3. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
    4. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org

    Protein Summary

    2op5 structure belongs to the SCOP alpha+beta class, superfamily of dimeric alpha+beta barrel, marine metagenome family DAB1. According to DALI, similar structures to 2op5 are PDB codes: 2od6 (Z=14), 3hx9 (Z=11), 2zdo (Z=10), 1sqe (Z=10), 1vqs, 2bbe, 1tz0, 1x7v, and 1lq9 (actva-orf6 monooxygenase; Z=9).

    Ligand Summary





    No references found.

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch